PNC-27
Oncology research Research only Animal studies
Also called p53-derived chimeric peptide
A 32-amino-acid hybrid that fuses a fragment of the p53 tumour-suppressor protein to a membrane-penetrating tail. Cancer cells carry HDM-2 in their membranes while healthy cells generally do not, so the peptide is reported to punch holes selectively in tumour cell membranes.
Evidence at a glance
- Evidence
- Animal studies — Not yet studied in people
- Status
- Research compound only
- Dosing
- No human study has set a dose
Cell and mouse data only, largely from the group that developed it, with no independent replication at scale and no human trials. Nothing here supports its use as a cancer treatment.
What studies report
- Killed a range of cancer cell lines in culture while sparing normal cells
- Tumour shrinkage in mouse xenograft models
- Acts by membrane disruption rather than by triggering normal apoptosis
How it works
Carries a p53 fragment attached to a membrane-penetrating tail. Cancer cells display HDM-2 in their membranes while healthy cells generally do not, so the peptide anchors there and ruptures the membrane — killing by physical disruption rather than by triggering normal cell death.
Where it acts
Acts body-wide rather than on one organThe library groups this compound under Oncology research. The diagram shows that target, not every tissue it reaches.
Illustrated
AI-generated subject illustration; not a depiction of the compound or evidence of its effects.
Why people take it
Reasons people seek it out — not a list of proven effects.
In practice Unapproved use
- Occasionally sought by patients outside clinical settings, which carries real risk
Science hasn't caught up: No human trials exist; any use is entirely unstudied.
Reported real-world use, not evidence and not a recommendation.
Status: Preclinical research only. Not approved.
- Route
- Subcutaneous injection, from reconstituted lyophilised powder
- Sequence
- PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
- Formula
- C188H293N53O44S
- Molecular weight
- 4032 g/mol
- CAS
- 1159861-00-3
- Available as
- 10 mg
Search PubMed for PNC-27 → We link a live search rather than a fixed citation list, so it stays current and nothing here is a reference we have not checked.
Educational information only. Nothing here is medical advice, a dosing protocol, or a recommendation to use any compound. Most entries describe substances not approved for human use. Talk to a licensed clinician before acting on anything you read here. How to read these entries.